- HOME
- Online Catalog
- Product Detail
MHC Class-I chain related gene A Human Recombinant
- Code:
- PRO-367
- Name:
- MHC Class-I chain related gene A Human Recombinant
- MHC class I polypeptide-related sequence A, MIC-A, MICA, PERB11.1, HLA-B, AS, HLAB, HLAC, SPDA1, HLA-B73, HLA-B-7301.
- EPHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLESGVVLRRTVPPMVNVTRSEASEGNITVTCRASSFYPRNIILTWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICRGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSH.
- Manufacturer [ Prospec ]
| Package | Price(Yen) | Availability |
|---|---|---|
| 2 µg | 18,000 | contact us |
| 10 µg | 36,250 | contact us |
| 1 mg | 1,020,000 | contact us |
| Bulk Request | ||
- main
- more information
- reference
main
- Purity:
- Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
- Storage:
- -20 ℃
- Source:
- Escherichia Coli.
- Production:
- MICA Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 320 amino acids and having a molecular mass of 36kDa. The sequence contains the full length extracellular domain of the mature human MICA (amino acid residues Ala23 – Gln308) The MICA is purified by proprietary chromatographic techniques.
more information
- Category:
- ProSpec
reference
Documents
Data Sheet
Search other product



