- HOME
- Online Catalog
- Product Detail
Hepatitis B Surface Antigen, preS1 Recombinant
- Code:
- HBS-871
- Name:
- Hepatitis B Surface Antigen, preS1 Recombinant
- MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQA.
- Manufacturer [ Prospec ]
| Package | Price(Yen) | Availability |
|---|---|---|
| 10 µg | 16,500 | contact us |
| 50 µg | 36,250 | contact us |
| 1 mg | 508,750 | contact us |
| Bulk Request | ||
- main
- more information
- reference
main
- Purity:
- Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
- Storage:
- -20 ℃
- Source:
- Escherichia Coli.
- Production:
- The E.Coli derived Recombinant Hepatitis B Surface Antigen preS1 is a single non-glycosylated polypeptide chain containing 119 amino acids and having a molecular weight of 12.6 kDa.
more information
- Category:
- ProSpec
reference
Documents
Data Sheet
Search other product
