- HOME
- Online Catalog
- Product Detail
Interleukin-19 Mouse Recombinant
- Code:
- CYT-855
- Name:
- Interleukin-19 Mouse Recombinant
- Interleukin-19, IL-19, Il19.
- MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA.
- Manufacturer [ Prospec ]
Package | Price(Yen) | Availability |
---|---|---|
2 µg | 18,000 | contact us |
10 µg | 36,250 | contact us |
1 mg | 1,170,000 | contact us |
Bulk Request |
- main
- more information
- reference
main
- Purity:
- Greater than 95.0% as determined by SDS-PAGE.
- Storage:
- -20 ℃
- Source:
- Escherichia Coli.
- Production:
- Interleukin-19 Mouse Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 153 amino acids and having a molecular mass of 17.7kDa. The IL-19 is purified by proprietary chromatographic techniques.
more information
- Category:
- ProSpec
reference
Documents
Data Sheet
Search other product