- HOME
- Online Catalog
- Product Detail
Allograft Inflammatory Factor 1 Human Recombinant
- Code:
- CYT-697
- Name:
- Allograft Inflammatory Factor 1 Human Recombinant
- AIF-1, Allograft inflammatory factor 1, Em:AF129756.17, G1, IBA1, Ionized calcium-binding adapter molecule 1, IRT-1, Protein G1, AIF1.
- MKHHHHHHASQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP.
- Manufacturer [ Prospec ]
| Package | Price(Yen) | Availability |
|---|---|---|
| 2 µg | 18,000 | contact us |
| 10 µg | 36,250 | contact us |
| 1 mg | 1,170,000 | contact us |
| Bulk Request | ||
- main
- more information
- reference
main
- Purity:
- Greater than 90% as determined by SDS PAGE.
- Storage:
- -20 ℃
- Source:
- E. Coli.
- Production:
- The AIF1 Human Recombinant contains a total of 155 amino acids having a molecular Mass of 17.7kDa. The Human AIF1 is fused to a 9 amino acid long N-terminal His tag.
more information
- Category:
- ProSpec
reference
Documents
Data Sheet
Search other product



