- HOME
- Online Catalog
- Product Detail
Noggin Mouse Recombinant
- Code:
- CYT-600
- Name:
- Noggin Mouse Recombinant
- Noggin, SYM1, SYNS1, NOG.
- MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGQRCGWIPIQYPIISECKCSC.
- Manufacturer [ Prospec ]
| Package | Price(Yen) | Availability |
|---|---|---|
| 5 µg | 18,000 | contact us |
| 20 µg | 36,250 | contact us |
| 1 mg | 877,500 | contact us |
| Bulk Request | ||
- main
- more information
- reference
main
- Purity:
- Greater than 95.0% as determined by SDS-PAGE.
- Storage:
- -20 ℃
- Source:
- Escherichia Coli.
- Production:
- Noggin Mouse Recombinant produced in E.Coli is a non-glycosylated, disulfide-linked protein consisting of two 206 amino acid polypeptide chains, having a total molecular mass of approximately 46.4 kDa (each chain 23.2 kDa).
more information
- Category:
- ProSpec
reference
Documents
Data Sheet
Search other product



