- HOME
- Online Catalog
- Product Detail
Macrophage Migration Inhibitory Factor Human Recombinant (Active)
- Code:
- CYT-596
- Name:
- Macrophage Migration Inhibitory Factor Human Recombinant (Active)
- Phenylpyruvate tautomerase, Glycosylation-inhibiting factor, GIF, MMIF, MIF.
- MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA.
- Manufacturer [ Prospec ]
Package | Price(Yen) | Availability |
---|---|---|
3 x 2 µg | 18,000 | contact us |
25 µg | 36,250 | contact us |
1 mg | 675,000 | contact us |
Bulk Request |
- main
- more information
- reference
main
- Purity:
- Greater than 97.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
- Storage:
- -20 ℃
- Source:
- Escherichia Coli.
- Production:
- MIF human Recombinant was cloned into an E.coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques.Macrophage Inducing Factor Human Recombinant is a single, non-glycosylated, polypeptide chain containing 115 amino acids and having a molecular mass of 12.5 kDa.
more information
- Category:
- ProSpec
reference
Documents
Data Sheet
Search other product