- HOME
- Online Catalog
- Product Detail
Prolactin Soluble Receptor Human Recombinant
- Code:
- CYT-595
- Name:
- Prolactin Soluble Receptor Human Recombinant
- PRL-R, hPRLrI.
- AGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTVW.
- Manufacturer [ Prospec ]
Package | Price(Yen) | Availability |
---|---|---|
5 µg | 18,000 | contact us |
20 µg | 36,250 | contact us |
1 mg | 840,000 | contact us |
Bulk Request |
- main
- more information
- reference
main
- Purity:
- Greater than 97.0% as determined by:(a) Analysis by SEC-HPLC. (b) Analysis by SDS-PAGE.(c) Gel filtration at pH 8 under non denaturative conditions.
- Storage:
- -20 ℃
- Source:
- Escherichia Coli.
- Production:
- Extra Cellular Domain Prolactin Receptor Human Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containsing 210 amino acids and having a molecular mass of 23.97 kDa. The Prolactin Receptor is purified by proprietary chromatographic techniques according to Bignon et al. (1994) JBC 269; 3318-24 and tested according to Gertler et al. (1996) JBC 271; 24482-91.
more information
- Category:
- ProSpec
reference
Documents
Data Sheet
Search other product