- HOME
- Online Catalog
- Product Detail
Growth Hormone Binding Protein Rabbit Recombinant
- Code:
- CYT-593
- Name:
- Growth Hormone Binding Protein Rabbit Recombinant
- GHR, GHBP, GH receptor, Somatotropin receptor.
- AFSGSEATPATLGRASESVQRVHPGLGTNSSGKPKFTKCRSPELETFSCHWTDGVHHGLKSPGSVQLFYIRRNTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTNNGGMVDQKCFSVEEIVQPDPPIGLNWTLLNVSLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRSSEKYGEFSEVLYVTLPQMSPFTCEEDFRFP.
- Manufacturer [ Prospec ]
| Package | Price(Yen) | Availability |
|---|---|---|
| 5 µg | 18,000 | contact us |
| 20 µg | 36,250 | contact us |
| 1 mg | 1,300,000 | contact us |
| Bulk Request | ||
- main
- more information
- reference
main
- Purity:
- Greater than 98.0% as determined bySDS-PAGE.
- Storage:
- -20 ℃
- Source:
- Escherichia Coli.
- Production:
- Growth Hormone Binding Protein Rabbit Extracellular Domain Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 249 amino acids and having a molecular mass of 28 kDa. GHBP Rabbit is purified by proprietary chromatographic techniques.
more information
- Category:
- ProSpec
reference
Documents
Data Sheet
Search other product



