- HOME
- Online Catalog
- Product Detail
Glia Maturation Factor Beta Human Recombinant
- Code:
- CYT-565
- Name:
- Glia Maturation Factor Beta Human Recombinant
- Glia maturation factor beta, GMFB, GMF-B, GMF-beta, GMF.
- SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQT AELTKVFEIRNTEDLTEEWLREKLGFFH.
- Manufacturer [ Prospec ]
Package | Price(Yen) | Availability |
---|---|---|
2 µg | 18,000 | contact us |
10 µg | 36,250 | contact us |
1 mg | 1,170,000 | contact us |
Bulk Request |
- main
- more information
- reference
main
- Purity:
- Greater than 98.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
- Storage:
- -20 ℃
- Source:
- Escherichia Coli.
- Production:
- Glia Maturation Factor-Beta (GMF-Beta) Human Recombinant produced in E.Coli is a signle, non-glycosylated, polypeptide chain containing 141 amino acids and having a total molecular mass of 16.5 kDa. Glia Maturation Factor-Beta, GMF-Beta, Human Recombinant is purified by proprietary chromatographic techniques.
more information
- Category:
- ProSpec
reference
Documents
Data Sheet
Search other product