- HOME
- Online Catalog
- Product Detail
Leptin Pufferfish Recombinant
- Code:
- CYT-530
- Name:
- Leptin Pufferfish Recombinant
- OB Protein, Obesity Protein, OBS, Obesity factor.
- ALPGALDAMDVEKMKSKVTWKAQGLVARIDKHFPDRGLRFDTDKVE GSTSVVASLESYNNLISDRFGGVSQIKTEISSLAGYLNHWREGNCQE QQPKVWPRRNIFNHTVSLEALMRVREFLKLLQKNVDLLERC
- Manufacturer [ Prospec ]
| Package | Price(Yen) | Availability |
|---|---|---|
| 20 µg | 30,000 | contact us |
| 100 µg | 75,000 | contact us |
| 1 mg | 450,000 | contact us |
| Bulk Request | ||
- main
- more information
- reference
main
- Purity:
- Greater than 99.0% as determined by:(a) Analysis by SEC-HPLC.(b) Analysis by SDS-PAGE.
- Storage:
- -20 ℃
- Source:
- Escherichia Coli.
- Production:
- Leptin Pufferfish (Takifugu rubripes) Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain having a molecular mass of 16 kDa. Bioactive Leptin Pufferfish (Takifugu rubripes) Recombinant was prepared according to the sequence published by Kurokawa et al. (2005)Peptides 26, 745-750 in two forms: monomer and covalent dimer. MS analysis revealed molecular masses of 15,291 and 30,585 Da, close to the theoretical values of 15,270 and 30,540 Da. CD spectra revealed high similarity to mammalian leptins. Other details of its preparation will be soon published by Yacobovitz et al (in press), General and Comparative Endocrinology.The Pufferfish Leptin is purified by proprietary chromatographic techniques.
more information
- Category:
- ProSpec
reference
Documents
Data Sheet
Search other product



