- HOME
- Online Catalog
- Product Detail
Macrophage Migration Inhibitory Factor Human Recombinant, His Tag C-Terminus
- Code:
- CYT-521
- Name:
- Macrophage Migration Inhibitory Factor Human Recombinant, His Tag C-Terminus
- Phenylpyruvate tautomerase, Glycosylation-inhibiting factor, GIF, MMIF, MIF.
- MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFALEHHHHHH.
- Manufacturer [ Prospec ]
| Package | Price(Yen) | Availability |
|---|---|---|
| 5 µg | 18,000 | contact us |
| 25 µg | 36,250 | contact us |
| 1 mg | 450,000 | contact us |
| Bulk Request | ||
- main
- more information
- reference
main
- Purity:
- Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
- Storage:
- -20 ℃
- Source:
- Escherichia Coli.
- Production:
- MIF human Recombinant, fused to His-tag at C-terminus, was cloned into an E. coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques.Macrophage Inducing Factor Human Recombinant is a single, non-glycosylated, polypeptide chaincontaining 123 amino acidsand having a molecular mass of 13.5 kDa.
more information
- Category:
- ProSpec
reference
Documents
Data Sheet
Search other product



