- HOME
- Online Catalog
- Product Detail
Transforming Growth Factor Beta 2 Human Recombinant
- Code:
- CYT-441
- Name:
- Transforming Growth Factor Beta 2 Human Recombinant
- Transforming growth factor, beta 2, cetermin, Glioblastoma-derived T-cell suppressor factor, polyergin, G-TSF, TGF-beta2, TGF-beta-2, transforming growth factor beta-2, BSC-1 cell growth inhibitor, TGFB-2.
- HHHHHHALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTI LYYIGKTPKIEQLSNMIVKSCKCS.
- Manufacturer [ Prospec ]
| Package | Price(Yen) | Availability |
|---|---|---|
| 1 µg | 18,000 | contact us |
| 5 µg | 36,250 | contact us |
| 100 µg | 375,000 | contact us |
| Bulk Request | ||
- main
- more information
- reference
main
- Purity:
- Greater than 97.0% as determined by SDS-PAGE.
- Storage:
- -20 ℃
- Source:
- Nicotiana benthamiana.
- Production:
- TGFB2 Human Recombinant produced in plants is a homodimeric polypeptide chain containing 2 x 118 amino acids and having a total molecular mass of 27.08kDa. The TGFB2 is fused to 6xHis Tag at N-terminus and purified by proprietary chromatographic techniques.
more information
- Category:
- ProSpec
reference
Documents
Data Sheet
Search other product
