- HOME
- Online Catalog
- Product Detail
Heregulin-B2 Human Recombinant
- Code:
- CYT-407
- Name:
- Heregulin-B2 Human Recombinant
- Neuregulin-1, NRG1, GGF, HGL, HRGA, NDF, SMDF, HRG, ARIA, GGF2, HRG1.
- SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKAEELYQ.
- Manufacturer [ Prospec ]
| Package | Price(Yen) | Availability |
|---|---|---|
| 10 µg | 18,000 | contact us |
| 50 µg | 36,250 | contact us |
| 1 mg | 337,500 | contact us |
| Bulk Request | ||
- main
- more information
- reference
main
- Purity:
- Greater than 96.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
- Storage:
- -20 ℃
- Source:
- Escherichia Coli.
- Production:
- Recombinant Human Neuregulin-1 beta 2 produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 61 amino acids and having a total molecular mass of 7.0kDa. NRG-1 is purified by proprietary chromatographic techniques.
more information
- Category:
- ProSpec
reference
Documents
Data Sheet
Search other product



