- HOME
- Online Catalog
- Product Detail
IGF1 Gilthead Seabream Recombinant
- Code:
- CYT-295
- Name:
- IGF1 Gilthead Seabream Recombinant
- Somatomedin C, IGF-I, IGFI.
- MSPETLCGAELVDTLQFVCGERGFYFSKPGYGPNARRSRGIVDECCFQSCELRRLEMYCAPAKTSK
- Manufacturer [ Prospec ]
Package | Price(Yen) | Availability |
---|---|---|
10 µg | 18,000 | contact us |
50 µg | 36,250 | contact us |
1 mg | 525,000 | contact us |
Bulk Request |
- main
- more information
- reference
main
- Purity:
- Greater than 98.0% as determined by:(a) Analysis by SEC-HPLC.(b) Analysis by SDS-PAGE.
- Storage:
- -20 ℃
- Source:
- Escherichia Coli.
- Production:
- IGF1 Gilthead SeabreamRecombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 68 amino acids and having a molecular mass of 7545.4 Dalton, the predicted pI=7.72.IGF-1 is purified by proprietary chromatographic techniques.
more information
- Category:
- ProSpec
reference
Documents
Data Sheet
Search other product