- HOME
- Online Catalog
- Product Detail
Fibroblast Growth Factor-basic Human Recombinant, HEK
- Code:
- CYT-085
- Name:
- Fibroblast Growth Factor-basic Human Recombinant, HEK
- Prostatropin, HBGH-2, HBGF-2, FGF-2, FGF-b.
- PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGV VSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYK.
- Manufacturer [ Prospec ]
Package | Price(Yen) | Availability |
---|---|---|
2µg | 10,000 | contact us |
10µg | 26,000 | contact us |
1mg | 840,000 | contact us |
Bulk Request |
- main
- more information
- reference
main
- Purity:
- Greater than 95% as obsereved by SDS-PAGE.
- Storage:
- -20 ℃
- Source:
- HEK.
- Production:
- FGF-2 Human Recombinant Thermostable produced in HEK cells is a non-glycosylated monomer, containing 154 amino acids and having a total molecular weight of 17kDa.FGF-2 Thermostable is a protein engineered FGF2 in order to enhance its thermostability without modifying its biological function.The FGF-b is purified by proprietary chromatographic techniques.
more information
- Category:
- ProSpec
reference
Documents
Data Sheet
Search other product