- HOME
- Online Catalog
- Product Detail
Bone Morphogenetic Protein-7 Human Recombinant, Plant
- Code:
- CYT-039
- Name:
- Bone Morphogenetic Protein-7 Human Recombinant, Plant
- Osteogenic Protein 1, BMP-7.
- HHHHHHSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSVILKKYRNMVVRACGCH.
- Manufacturer [ Prospec ]
| Package | Price(Yen) | Availability |
|---|---|---|
| 2 µg | 18,000 | contact us |
| 10 µg | 36,250 | contact us |
| 1 mg | 1,750,000 | contact us |
| Bulk Request | ||
- main
- more information
- reference
main
- Purity:
- Greater than 97.0% as determined by SDS-PAGE.
- Storage:
- -20 ℃
- Source:
- Nicotiana benthamiana.
- Production:
- Bone Morphogenetic Protein-7 Human Recombinant produced in Plant is a monomeric, glycosylated, polypeptide chain containing 144 amino acids and having a molecular mass of 16.5kDa, and fused to a 6xHis-tag at the N-terminus. The BMP-7 is purified by proprietary chromatographic techniques.
more information
- Category:
- ProSpec
reference
Documents
Data Sheet
Search other product



