- HOME
- Online Catalog
- Product Detail
Macrophage Inflammatory Protein-5 Human Recombinant (CCL15)
- Code:
- CHM-230
- Name:
- Macrophage Inflammatory Protein-5 Human Recombinant (CCL15)
- Small inducible cytokine A15 precursor, CCL15, Macrophage inflammatory protein 5, MIP-5, MIP5, Chemokine CC-2, HCC-2, NCC-3, MIP- 1 delta, Leukotactin-1, LKN-1, Mrp-2b, C-C motif chemokine 15.
- QFINDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKP GVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI.
- Manufacturer [ Prospec ]
Package | Price(Yen) | Availability |
---|---|---|
5 µg | 18,000 | contact us |
25 µg | 36,250 | contact us |
1 mg | 675,000 | contact us |
Bulk Request |
- main
- more information
- reference
main
- Purity:
- Greater than 97.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
- Storage:
- -20 ℃
- Source:
- Escherichia Coli.
- Production:
- Macrophage Inflammatory Protein-5 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 92 amino acids and having a molecular mass of 10.1 kDa. The MIP5 is purified by proprietary chromatographic techniques.
more information
- Category:
- ProSpec
reference
Documents
Data Sheet
Search other product